Anti ZNF169 pAb (ATL-HPA061185)

Atlas Antibodies

Catalog No: ATL-HPA061185-25

• 

Product Description

Protein Description: zinc finger protein 169
Gene Name: ZNF169
Alternative Gene Name: MGC51961
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050954: 55%, ENSRNOG00000017092: 51%
Entrez Gene ID: 169841
Uniprot ID: Q14929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDEPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIFPSSSAGGDFQLEAPRCSSE
• Gene Sequence: GDEPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIFPSSSAGGDFQLEAPRCSSE
• Gene ID - Mouse: ENSMUSG00000050954
• Gene ID - Rat: ENSRNOG00000017092
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.