Anti ZNF16 pAb (ATL-HPA061835)

Atlas Antibodies

Catalog No: ATL-HPA061835-25

• 

Product Description

Protein Description: zinc finger protein 16
Gene Name: ZNF16
Alternative Gene Name: KOX9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068962: 36%, ENSRNOG00000032625: 36%
Entrez Gene ID: 7564
Uniprot ID: P17020
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGLLRGPLGEKDLDCNGFDSRFSLSPNLMACQEIPTEERPHPYDMGGQSFQHSVDLTGHEGVPTAESPL
• Gene Sequence: MGLLRGPLGEKDLDCNGFDSRFSLSPNLMACQEIPTEERPHPYDMGGQSFQHSVDLTGHEGVPTAESPL
• Gene ID - Mouse: ENSMUSG00000068962
• Gene ID - Rat: ENSRNOG00000032625
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.