Description
Product Description
Protein Description: zinc finger protein 154
Gene Name: ZNF154
Alternative Gene Name: pHZ-92
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030443: 36%, ENSRNOG00000034184: 36%
Entrez Gene ID: 7710
Uniprot ID: Q13106
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF154
Alternative Gene Name: pHZ-92
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030443: 36%, ENSRNOG00000034184: 36%
Entrez Gene ID: 7710
Uniprot ID: Q13106
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LAKLGFLHQQAAHTGEQSNSKSDGGAISHRGKTHYNCGEHTKAFSGKHTLVQQQRTLTTERCY |
Gene Sequence | LAKLGFLHQQAAHTGEQSNSKSDGGAISHRGKTHYNCGEHTKAFSGKHTLVQQQRTLTTERCY |
Gene ID - Mouse | ENSMUSG00000030443 |
Gene ID - Rat | ENSRNOG00000034184 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZNF154 pAb (ATL-HPA076284) | |
Datasheet | Anti ZNF154 pAb (ATL-HPA076284) Datasheet (External Link) |
Vendor Page | Anti ZNF154 pAb (ATL-HPA076284) at Atlas Antibodies |
Documents & Links for Anti ZNF154 pAb (ATL-HPA076284) | |
Datasheet | Anti ZNF154 pAb (ATL-HPA076284) Datasheet (External Link) |
Vendor Page | Anti ZNF154 pAb (ATL-HPA076284) |