Protein Description: zinc finger protein 12
Gene Name: ZNF12
Alternative Gene Name: GIOT-3, KOX3, ZNF325
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029587: 67%, ENSRNOG00000006958: 63%
Entrez Gene ID: 7559
Uniprot ID: P17014
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZNF12
Alternative Gene Name: GIOT-3, KOX3, ZNF325
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029587: 67%, ENSRNOG00000006958: 63%
Entrez Gene ID: 7559
Uniprot ID: P17014
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EYIECQKAFQKDTVFVNHMEEKPYKWNGSEIAFLQMSDLTVHQTSHMEMKPY |
Documents & Links for Anti ZNF12 pAb (ATL-HPA063402) | |
Datasheet | Anti ZNF12 pAb (ATL-HPA063402) Datasheet (External Link) |
Vendor Page | Anti ZNF12 pAb (ATL-HPA063402) at Atlas |
Documents & Links for Anti ZNF12 pAb (ATL-HPA063402) | |
Datasheet | Anti ZNF12 pAb (ATL-HPA063402) Datasheet (External Link) |
Vendor Page | Anti ZNF12 pAb (ATL-HPA063402) |