Anti ZNF12 pAb (ATL-HPA063402)

Atlas Antibodies

Catalog No: ATL-HPA063402-25

• 

Product Description

Protein Description: zinc finger protein 12
Gene Name: ZNF12
Alternative Gene Name: GIOT-3, KOX3, ZNF325
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029587: 67%, ENSRNOG00000006958: 63%
Entrez Gene ID: 7559
Uniprot ID: P17014
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EYIECQKAFQKDTVFVNHMEEKPYKWNGSEIAFLQMSDLTVHQTSHMEMKPY
• Gene Sequence: EYIECQKAFQKDTVFVNHMEEKPYKWNGSEIAFLQMSDLTVHQTSHMEMKPY
• Gene ID - Mouse: ENSMUSG00000029587
• Gene ID - Rat: ENSRNOG00000006958
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.