Description
Product Description
Protein Description: zinc finger MYM-type containing 3
Gene Name: ZMYM3
Alternative Gene Name: DXS6673E, KIAA0385, MYM, ZNF198L2, ZNF261
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031310: 96%, ENSRNOG00000003707: 97%
Entrez Gene ID: 9203
Uniprot ID: Q14202
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZMYM3
Alternative Gene Name: DXS6673E, KIAA0385, MYM, ZNF198L2, ZNF261
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031310: 96%, ENSRNOG00000003707: 97%
Entrez Gene ID: 9203
Uniprot ID: Q14202
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGPSPSSGALDLLDTPAGLEKDPGVLDGATE |
Gene Sequence | MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGPSPSSGALDLLDTPAGLEKDPGVLDGATE |
Gene ID - Mouse | ENSMUSG00000031310 |
Gene ID - Rat | ENSRNOG00000003707 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZMYM3 pAb (ATL-HPA075255) | |
Datasheet | Anti ZMYM3 pAb (ATL-HPA075255) Datasheet (External Link) |
Vendor Page | Anti ZMYM3 pAb (ATL-HPA075255) at Atlas Antibodies |
Documents & Links for Anti ZMYM3 pAb (ATL-HPA075255) | |
Datasheet | Anti ZMYM3 pAb (ATL-HPA075255) Datasheet (External Link) |
Vendor Page | Anti ZMYM3 pAb (ATL-HPA075255) |