Description
Product Description
Protein Description: zinc finger MIZ-type containing 1
Gene Name: ZMIZ1
Alternative Gene Name: FLJ13541, hZIMP10, KIAA1224, MIZ, RAI17, RP11-519K18.1, Zimp10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007817: 94%, ENSRNOG00000010488: 94%
Entrez Gene ID: 57178
Uniprot ID: Q9ULJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZMIZ1
Alternative Gene Name: FLJ13541, hZIMP10, KIAA1224, MIZ, RAI17, RP11-519K18.1, Zimp10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007817: 94%, ENSRNOG00000010488: 94%
Entrez Gene ID: 57178
Uniprot ID: Q9ULJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EPNYGNQQYGPNSQFPTQPGQYPAPNPPRPLTSPNYPGQRMPSQPSSGQYPPPTVNMGQYYKPEQFNGQNNTFSGSSYSNYSQGNV |
Gene Sequence | EPNYGNQQYGPNSQFPTQPGQYPAPNPPRPLTSPNYPGQRMPSQPSSGQYPPPTVNMGQYYKPEQFNGQNNTFSGSSYSNYSQGNV |
Gene ID - Mouse | ENSMUSG00000007817 |
Gene ID - Rat | ENSRNOG00000010488 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZMIZ1 pAb (ATL-HPA071156) | |
Datasheet | Anti ZMIZ1 pAb (ATL-HPA071156) Datasheet (External Link) |
Vendor Page | Anti ZMIZ1 pAb (ATL-HPA071156) at Atlas Antibodies |
Documents & Links for Anti ZMIZ1 pAb (ATL-HPA071156) | |
Datasheet | Anti ZMIZ1 pAb (ATL-HPA071156) Datasheet (External Link) |
Vendor Page | Anti ZMIZ1 pAb (ATL-HPA071156) |