Description
Product Description
Protein Description: zinc finger with KRAB and SCAN domains 7
Gene Name: ZKSCAN7
Alternative Gene Name: FLJ12738, ZNF167, ZNF448, ZNF64, ZSCAN39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063488: 49%, ENSRNOG00000004104: 56%
Entrez Gene ID: 55888
Uniprot ID: Q9P0L1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZKSCAN7
Alternative Gene Name: FLJ12738, ZNF167, ZNF448, ZNF64, ZSCAN39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063488: 49%, ENSRNOG00000004104: 56%
Entrez Gene ID: 55888
Uniprot ID: Q9P0L1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MMESSELTPKQEIFKGSESSNSTSGGLFGVVPGGTETGDVCEDTFKELEGQPSNEEGSRLESDFLEIIDEDKK |
Gene Sequence | MMESSELTPKQEIFKGSESSNSTSGGLFGVVPGGTETGDVCEDTFKELEGQPSNEEGSRLESDFLEIIDEDKK |
Gene ID - Mouse | ENSMUSG00000063488 |
Gene ID - Rat | ENSRNOG00000004104 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZKSCAN7 pAb (ATL-HPA071850) | |
Datasheet | Anti ZKSCAN7 pAb (ATL-HPA071850) Datasheet (External Link) |
Vendor Page | Anti ZKSCAN7 pAb (ATL-HPA071850) at Atlas Antibodies |
Documents & Links for Anti ZKSCAN7 pAb (ATL-HPA071850) | |
Datasheet | Anti ZKSCAN7 pAb (ATL-HPA071850) Datasheet (External Link) |
Vendor Page | Anti ZKSCAN7 pAb (ATL-HPA071850) |