Anti ZKSCAN7 pAb (ATL-HPA071850)

Atlas Antibodies

Catalog No: ATL-HPA071850-25

• 
• 

Product Description

Protein Description: zinc finger with KRAB and SCAN domains 7
Gene Name: ZKSCAN7
Alternative Gene Name: FLJ12738, ZNF167, ZNF448, ZNF64, ZSCAN39
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063488: 49%, ENSRNOG00000004104: 56%
Entrez Gene ID: 55888
Uniprot ID: Q9P0L1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MMESSELTPKQEIFKGSESSNSTSGGLFGVVPGGTETGDVCEDTFKELEGQPSNEEGSRLESDFLEIIDEDKK
• Gene Sequence: MMESSELTPKQEIFKGSESSNSTSGGLFGVVPGGTETGDVCEDTFKELEGQPSNEEGSRLESDFLEIIDEDKK
• Gene ID - Mouse: ENSMUSG00000063488
• Gene ID - Rat: ENSRNOG00000004104
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.