Anti ZIM2 pAb (ATL-HPA071856)

Catalog No:
ATL-HPA071856-25
$447.00

Description

Product Description

Protein Description: zinc finger, imprinted 2
Gene Name: ZIM2
Alternative Gene Name: ZNF656
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075225: 30%, ENSRNOG00000031478: 31%
Entrez Gene ID: 23619
Uniprot ID: Q9NZV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKTLTPERSYGSDEFERSSNLSKQSKDPLGKDPQEGTAPGICTSPQSASQENKHNRCEFCKRTFSTQVALRR
Gene Sequence PKTLTPERSYGSDEFERSSNLSKQSKDPLGKDPQEGTAPGICTSPQSASQENKHNRCEFCKRTFSTQVALRR
Gene ID - Mouse ENSMUSG00000075225
Gene ID - Rat ENSRNOG00000031478
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZIM2 pAb (ATL-HPA071856)
Datasheet Anti ZIM2 pAb (ATL-HPA071856) Datasheet (External Link)
Vendor Page Anti ZIM2 pAb (ATL-HPA071856) at Atlas Antibodies

Documents & Links for Anti ZIM2 pAb (ATL-HPA071856)
Datasheet Anti ZIM2 pAb (ATL-HPA071856) Datasheet (External Link)
Vendor Page Anti ZIM2 pAb (ATL-HPA071856)

Product Description

Protein Description: zinc finger, imprinted 2
Gene Name: ZIM2
Alternative Gene Name: ZNF656
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075225: 30%, ENSRNOG00000031478: 31%
Entrez Gene ID: 23619
Uniprot ID: Q9NZV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKTLTPERSYGSDEFERSSNLSKQSKDPLGKDPQEGTAPGICTSPQSASQENKHNRCEFCKRTFSTQVALRR
Gene Sequence PKTLTPERSYGSDEFERSSNLSKQSKDPLGKDPQEGTAPGICTSPQSASQENKHNRCEFCKRTFSTQVALRR
Gene ID - Mouse ENSMUSG00000075225
Gene ID - Rat ENSRNOG00000031478
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZIM2 pAb (ATL-HPA071856)
Datasheet Anti ZIM2 pAb (ATL-HPA071856) Datasheet (External Link)
Vendor Page Anti ZIM2 pAb (ATL-HPA071856) at Atlas Antibodies

Documents & Links for Anti ZIM2 pAb (ATL-HPA071856)
Datasheet Anti ZIM2 pAb (ATL-HPA071856) Datasheet (External Link)
Vendor Page Anti ZIM2 pAb (ATL-HPA071856)