Description
Product Description
Protein Description: zinc finger, imprinted 2
Gene Name: ZIM2
Alternative Gene Name: ZNF656
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075225: 30%, ENSRNOG00000031478: 31%
Entrez Gene ID: 23619
Uniprot ID: Q9NZV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZIM2
Alternative Gene Name: ZNF656
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075225: 30%, ENSRNOG00000031478: 31%
Entrez Gene ID: 23619
Uniprot ID: Q9NZV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PKTLTPERSYGSDEFERSSNLSKQSKDPLGKDPQEGTAPGICTSPQSASQENKHNRCEFCKRTFSTQVALRR |
Gene Sequence | PKTLTPERSYGSDEFERSSNLSKQSKDPLGKDPQEGTAPGICTSPQSASQENKHNRCEFCKRTFSTQVALRR |
Gene ID - Mouse | ENSMUSG00000075225 |
Gene ID - Rat | ENSRNOG00000031478 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZIM2 pAb (ATL-HPA071856) | |
Datasheet | Anti ZIM2 pAb (ATL-HPA071856) Datasheet (External Link) |
Vendor Page | Anti ZIM2 pAb (ATL-HPA071856) at Atlas Antibodies |
Documents & Links for Anti ZIM2 pAb (ATL-HPA071856) | |
Datasheet | Anti ZIM2 pAb (ATL-HPA071856) Datasheet (External Link) |
Vendor Page | Anti ZIM2 pAb (ATL-HPA071856) |