Protein Description: zinc finger, imprinted 2
Gene Name: ZIM2
Alternative Gene Name: ZNF656
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075225: 30%, ENSRNOG00000031478: 31%
Entrez Gene ID: 23619
Uniprot ID: Q9NZV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZIM2
Alternative Gene Name: ZNF656
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075225: 30%, ENSRNOG00000031478: 31%
Entrez Gene ID: 23619
Uniprot ID: Q9NZV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PKTLTPERSYGSDEFERSSNLSKQSKDPLGKDPQEGTAPGICTSPQSASQENKHNRCEFCKRTFSTQVALRR |
| Documents & Links for Anti ZIM2 pAb (ATL-HPA071856) | |
| Datasheet | Anti ZIM2 pAb (ATL-HPA071856) Datasheet (External Link) |
| Vendor Page | Anti ZIM2 pAb (ATL-HPA071856) at Atlas |
| Documents & Links for Anti ZIM2 pAb (ATL-HPA071856) | |
| Datasheet | Anti ZIM2 pAb (ATL-HPA071856) Datasheet (External Link) |
| Vendor Page | Anti ZIM2 pAb (ATL-HPA071856) |