Description
Product Description
Protein Description: zinc finger, CCCH-type with G patch domain
Gene Name: ZGPAT
Alternative Gene Name: dJ583P15.3, FLJ14972, GPATC6, GPATCH6, KIAA1847, MGC44880, ZC3H9, ZC3HDC9, ZIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027582: 78%, ENSRNOG00000014235: 78%
Entrez Gene ID: 84619
Uniprot ID: Q8N5A5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZGPAT
Alternative Gene Name: dJ583P15.3, FLJ14972, GPATC6, GPATCH6, KIAA1847, MGC44880, ZC3H9, ZC3HDC9, ZIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027582: 78%, ENSRNOG00000014235: 78%
Entrez Gene ID: 84619
Uniprot ID: Q8N5A5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQCVETLQKQTRVG |
Gene Sequence | ALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRVEPIHAVVLPRGKSLDQCVETLQKQTRVG |
Gene ID - Mouse | ENSMUSG00000027582 |
Gene ID - Rat | ENSRNOG00000014235 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZGPAT pAb (ATL-HPA056705) | |
Datasheet | Anti ZGPAT pAb (ATL-HPA056705) Datasheet (External Link) |
Vendor Page | Anti ZGPAT pAb (ATL-HPA056705) at Atlas Antibodies |
Documents & Links for Anti ZGPAT pAb (ATL-HPA056705) | |
Datasheet | Anti ZGPAT pAb (ATL-HPA056705) Datasheet (External Link) |
Vendor Page | Anti ZGPAT pAb (ATL-HPA056705) |