Description
Product Description
Protein Description: zinc finger, FYVE domain containing 9
Gene Name: ZFYVE9
Alternative Gene Name: MADHIP, PPP1R173, SARA, SMADIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034557: 82%, ENSRNOG00000027183: 77%
Entrez Gene ID: 9372
Uniprot ID: O95405
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZFYVE9
Alternative Gene Name: MADHIP, PPP1R173, SARA, SMADIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034557: 82%, ENSRNOG00000027183: 77%
Entrez Gene ID: 9372
Uniprot ID: O95405
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDSYGMQDPGVSFVPKTLPSKEDSVTEEKEIEESKSECYSN |
Gene Sequence | QPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDSYGMQDPGVSFVPKTLPSKEDSVTEEKEIEESKSECYSN |
Gene ID - Mouse | ENSMUSG00000034557 |
Gene ID - Rat | ENSRNOG00000027183 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZFYVE9 pAb (ATL-HPA065852) | |
Datasheet | Anti ZFYVE9 pAb (ATL-HPA065852) Datasheet (External Link) |
Vendor Page | Anti ZFYVE9 pAb (ATL-HPA065852) at Atlas Antibodies |
Documents & Links for Anti ZFYVE9 pAb (ATL-HPA065852) | |
Datasheet | Anti ZFYVE9 pAb (ATL-HPA065852) Datasheet (External Link) |
Vendor Page | Anti ZFYVE9 pAb (ATL-HPA065852) |
Citations
Citations for Anti ZFYVE9 pAb (ATL-HPA065852) – 1 Found |
Bohl, Bettina; Jabali, Ammar; Ladewig, Julia; Koch, Philipp. Asymmetric Notch activity by differential inheritance of lysosomes in human neural stem cells. Science Advances. 2022;8(6):eabl5792. PubMed |