Protein Description: ZFP1 zinc finger protein
Gene Name: ZFP1
Alternative Gene Name: FLJ34243, ZNF475
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055835: 67%, ENSRNOG00000019059: 64%
Entrez Gene ID: 162239
Uniprot ID: Q6P2D0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZFP1
Alternative Gene Name: FLJ34243, ZNF475
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055835: 67%, ENSRNOG00000019059: 64%
Entrez Gene ID: 162239
Uniprot ID: Q6P2D0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAIFKHQKIKNLVQPFICTYCDK |
| Documents & Links for Anti ZFP1 pAb (ATL-HPA062910) | |
| Datasheet | Anti ZFP1 pAb (ATL-HPA062910) Datasheet (External Link) |
| Vendor Page | Anti ZFP1 pAb (ATL-HPA062910) at Atlas |
| Documents & Links for Anti ZFP1 pAb (ATL-HPA062910) | |
| Datasheet | Anti ZFP1 pAb (ATL-HPA062910) Datasheet (External Link) |
| Vendor Page | Anti ZFP1 pAb (ATL-HPA062910) |