Description
Product Description
Protein Description: zinc finger, DHHC-type containing 7
Gene Name: ZDHHC7
Alternative Gene Name: FLJ10792, FLJ20279, SERZ-B, SERZ1, ZNF370
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031823: 91%, ENSRNOG00000017342: 92%
Entrez Gene ID: 55625
Uniprot ID: Q9NXF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZDHHC7
Alternative Gene Name: FLJ10792, FLJ20279, SERZ-B, SERZ1, ZNF370
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031823: 91%, ENSRNOG00000017342: 92%
Entrez Gene ID: 55625
Uniprot ID: Q9NXF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LKSENPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFS |
| Gene Sequence | LKSENPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFS |
| Gene ID - Mouse | ENSMUSG00000031823 |
| Gene ID - Rat | ENSRNOG00000017342 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti ZDHHC7 pAb (ATL-HPA059054) | |
| Datasheet | Anti ZDHHC7 pAb (ATL-HPA059054) Datasheet (External Link) |
| Vendor Page | Anti ZDHHC7 pAb (ATL-HPA059054) at Atlas Antibodies |
| Documents & Links for Anti ZDHHC7 pAb (ATL-HPA059054) | |
| Datasheet | Anti ZDHHC7 pAb (ATL-HPA059054) Datasheet (External Link) |
| Vendor Page | Anti ZDHHC7 pAb (ATL-HPA059054) |