Anti ZDHHC22 pAb (ATL-HPA072213)

Catalog No:
ATL-HPA072213-25
$303.00

Description

Product Description

Protein Description: zinc finger, DHHC-type containing 22
Gene Name: ZDHHC22
Alternative Gene Name: C14orf59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048483: 94%, ENSRNOG00000011285: 96%
Entrez Gene ID: 283576
Uniprot ID: Q8N966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QTRHQVRKGVAVRARPWRKNLQEVFGKRWLLGLLVPMFNVGSESSKQQDK
Gene Sequence QTRHQVRKGVAVRARPWRKNLQEVFGKRWLLGLLVPMFNVGSESSKQQDK
Gene ID - Mouse ENSMUSG00000048483
Gene ID - Rat ENSRNOG00000011285
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZDHHC22 pAb (ATL-HPA072213)
Datasheet Anti ZDHHC22 pAb (ATL-HPA072213) Datasheet (External Link)
Vendor Page Anti ZDHHC22 pAb (ATL-HPA072213) at Atlas Antibodies

Documents & Links for Anti ZDHHC22 pAb (ATL-HPA072213)
Datasheet Anti ZDHHC22 pAb (ATL-HPA072213) Datasheet (External Link)
Vendor Page Anti ZDHHC22 pAb (ATL-HPA072213)

Product Description

Protein Description: zinc finger, DHHC-type containing 22
Gene Name: ZDHHC22
Alternative Gene Name: C14orf59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048483: 94%, ENSRNOG00000011285: 96%
Entrez Gene ID: 283576
Uniprot ID: Q8N966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QTRHQVRKGVAVRARPWRKNLQEVFGKRWLLGLLVPMFNVGSESSKQQDK
Gene Sequence QTRHQVRKGVAVRARPWRKNLQEVFGKRWLLGLLVPMFNVGSESSKQQDK
Gene ID - Mouse ENSMUSG00000048483
Gene ID - Rat ENSRNOG00000011285
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZDHHC22 pAb (ATL-HPA072213)
Datasheet Anti ZDHHC22 pAb (ATL-HPA072213) Datasheet (External Link)
Vendor Page Anti ZDHHC22 pAb (ATL-HPA072213) at Atlas Antibodies

Documents & Links for Anti ZDHHC22 pAb (ATL-HPA072213)
Datasheet Anti ZDHHC22 pAb (ATL-HPA072213) Datasheet (External Link)
Vendor Page Anti ZDHHC22 pAb (ATL-HPA072213)