Anti ZDHHC22 pAb (ATL-HPA072213)

Atlas Antibodies

Catalog No: ATL-HPA072213-25

• 

Product Description

Protein Description: zinc finger, DHHC-type containing 22
Gene Name: ZDHHC22
Alternative Gene Name: C14orf59
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048483: 94%, ENSRNOG00000011285: 96%
Entrez Gene ID: 283576
Uniprot ID: Q8N966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QTRHQVRKGVAVRARPWRKNLQEVFGKRWLLGLLVPMFNVGSESSKQQDK
• Gene Sequence: QTRHQVRKGVAVRARPWRKNLQEVFGKRWLLGLLVPMFNVGSESSKQQDK
• Gene ID - Mouse: ENSMUSG00000048483
• Gene ID - Rat: ENSRNOG00000011285
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.