Protein Description: zinc finger, DHHC-type containing 14
Gene Name: ZDHHC14
Alternative Gene Name: FLJ20984, NEW1CP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034265: 98%, ENSRNOG00000029049: 100%
Entrez Gene ID: 79683
Uniprot ID: Q8IZN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZDHHC14
Alternative Gene Name: FLJ20984, NEW1CP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034265: 98%, ENSRNOG00000029049: 100%
Entrez Gene ID: 79683
Uniprot ID: Q8IZN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FTNCCVALCGPISPSLIDRRGYIQPDTPQPAAPSNGITMYGATQSQSDMCDQDQCIQSTKFV |
| Documents & Links for Anti ZDHHC14 pAb (ATL-HPA063754) | |
| Datasheet | Anti ZDHHC14 pAb (ATL-HPA063754) Datasheet (External Link) |
| Vendor Page | Anti ZDHHC14 pAb (ATL-HPA063754) at Atlas |
| Documents & Links for Anti ZDHHC14 pAb (ATL-HPA063754) | |
| Datasheet | Anti ZDHHC14 pAb (ATL-HPA063754) Datasheet (External Link) |
| Vendor Page | Anti ZDHHC14 pAb (ATL-HPA063754) |