Protein Description: zinc finger, CCHC domain containing 7
Gene Name: ZCCHC7
Alternative Gene Name: AIR1, FLJ22611
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035649: 51%, ENSRNOG00000013078: 53%
Entrez Gene ID: 84186
Uniprot ID: Q8N3Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZCCHC7
Alternative Gene Name: AIR1, FLJ22611
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035649: 51%, ENSRNOG00000013078: 53%
Entrez Gene ID: 84186
Uniprot ID: Q8N3Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SNRWPQENKETQKEMKNKNRNWEKHRKADRHREVDEDFPRGPKTYSSPGSFKTQKPSKPFHRSSHYHTSREDKSPKEGKRGKQKKKERCWEDDDNDNLFLIKQ |
| Documents & Links for Anti ZCCHC7 pAb (ATL-HPA020600) | |
| Datasheet | Anti ZCCHC7 pAb (ATL-HPA020600) Datasheet (External Link) |
| Vendor Page | Anti ZCCHC7 pAb (ATL-HPA020600) at Atlas |
| Documents & Links for Anti ZCCHC7 pAb (ATL-HPA020600) | |
| Datasheet | Anti ZCCHC7 pAb (ATL-HPA020600) Datasheet (External Link) |
| Vendor Page | Anti ZCCHC7 pAb (ATL-HPA020600) |