Protein Description: zinc finger, CCHC domain containing 6
Gene Name: ZCCHC6
Alternative Gene Name: FLJ13409, KIAA1711, PAPD6, TUT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035248: 38%, ENSRNOG00000016629: 37%
Entrez Gene ID: 79670
Uniprot ID: Q5VYS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZCCHC6
Alternative Gene Name: FLJ13409, KIAA1711, PAPD6, TUT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035248: 38%, ENSRNOG00000016629: 37%
Entrez Gene ID: 79670
Uniprot ID: Q5VYS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DDYKGDKVYHPETGRKNEKEKVGRKGKHLLTVDQKRGEHVVCGSTRNNESESTLDLEGFQNPTAKECEGLATLDNKADLDGESTEGTEELEDSLNHFTHSVQGQ |
Documents & Links for Anti ZCCHC6 pAb (ATL-HPA020620) | |
Datasheet | Anti ZCCHC6 pAb (ATL-HPA020620) Datasheet (External Link) |
Vendor Page | Anti ZCCHC6 pAb (ATL-HPA020620) at Atlas |
Documents & Links for Anti ZCCHC6 pAb (ATL-HPA020620) | |
Datasheet | Anti ZCCHC6 pAb (ATL-HPA020620) Datasheet (External Link) |
Vendor Page | Anti ZCCHC6 pAb (ATL-HPA020620) |
Citations for Anti ZCCHC6 pAb (ATL-HPA020620) – 2 Found |
Warkocki, Zbigniew; Krawczyk, Paweł S; Adamska, Dorota; Bijata, Krystian; Garcia-Perez, Jose L; Dziembowski, Andrzej. Uridylation by TUT4/7 Restricts Retrotransposition of Human LINE-1s. Cell. 2018;174(6):1537-1548.e29. PubMed |
Takahashi, Kazutoshi; Jeong, Daeun; Wang, Songnan; Narita, Megumi; Jin, Xuemei; Iwasaki, Mio; Perli, Samuel D; Conklin, Bruce R; Yamanaka, Shinya. Critical Roles of Translation Initiation and RNA Uridylation in Endogenous Retroviral Expression and Neural Differentiation in Pluripotent Stem Cells. Cell Reports. 2020;31(9):107715. PubMed |