Description
Product Description
Protein Description: zinc finger CCCH-type, antiviral 1
Gene Name: ZC3HAV1
Alternative Gene Name: FLB6421, FLJ13288, MGC48898, PARP13, ZAP, ZC3H2, ZC3HDC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029826: 87%, ENSRNOG00000013948: 87%
Entrez Gene ID: 56829
Uniprot ID: Q7Z2W4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZC3HAV1
Alternative Gene Name: FLB6421, FLJ13288, MGC48898, PARP13, ZAP, ZC3H2, ZC3HDC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029826: 87%, ENSRNOG00000013948: 87%
Entrez Gene ID: 56829
Uniprot ID: Q7Z2W4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RFVVLETGGEAGITRSVVATTRARVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNK |
| Gene Sequence | RFVVLETGGEAGITRSVVATTRARVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNK |
| Gene ID - Mouse | ENSMUSG00000029826 |
| Gene ID - Rat | ENSRNOG00000013948 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti ZC3HAV1 pAb (ATL-HPA059096) | |
| Datasheet | Anti ZC3HAV1 pAb (ATL-HPA059096) Datasheet (External Link) |
| Vendor Page | Anti ZC3HAV1 pAb (ATL-HPA059096) at Atlas Antibodies |
| Documents & Links for Anti ZC3HAV1 pAb (ATL-HPA059096) | |
| Datasheet | Anti ZC3HAV1 pAb (ATL-HPA059096) Datasheet (External Link) |
| Vendor Page | Anti ZC3HAV1 pAb (ATL-HPA059096) |