![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/101567/181697/atl-hpa076092_anti-zc3h7b-pab-atl-hpa076092_63365__97589.1681138082.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101567/181697/atl-hpa076092_anti-zc3h7b-pab-atl-hpa076092_63365__97589.1681138082.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Description
Product Description
Protein Description: zinc finger CCCH-type containing 7B
Gene Name: ZC3H7B
Alternative Gene Name: DKFZp434K0920, FLJ13787, KIAA1031, RoXaN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022390: 89%, ENSRNOG00000055925: 89%
Entrez Gene ID: 23264
Uniprot ID: Q9UGR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZC3H7B
Alternative Gene Name: DKFZp434K0920, FLJ13787, KIAA1031, RoXaN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022390: 89%, ENSRNOG00000055925: 89%
Entrez Gene ID: 23264
Uniprot ID: Q9UGR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TFSLLSNGTAAGVADQGTSNGLGSIDDIETDCYVDPRGSPALLPSTPTMPLFPHVLDLLAPLDSSRTLPSTDSLDDFSDG |
| Gene Sequence | TFSLLSNGTAAGVADQGTSNGLGSIDDIETDCYVDPRGSPALLPSTPTMPLFPHVLDLLAPLDSSRTLPSTDSLDDFSDG |
| Gene ID - Mouse | ENSMUSG00000022390 |
| Gene ID - Rat | ENSRNOG00000055925 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti ZC3H7B pAb (ATL-HPA076092) | |
| Datasheet | Anti ZC3H7B pAb (ATL-HPA076092) Datasheet (External Link) |
| Vendor Page | Anti ZC3H7B pAb (ATL-HPA076092) at Atlas Antibodies |
| Documents & Links for Anti ZC3H7B pAb (ATL-HPA076092) | |
| Datasheet | Anti ZC3H7B pAb (ATL-HPA076092) Datasheet (External Link) |
| Vendor Page | Anti ZC3H7B pAb (ATL-HPA076092) |