Protein Description: zinc finger CCCH-type containing 6
Gene Name: ZC3H6
Alternative Gene Name: FLJ41410, FLJ45877, KIAA2035, ZC3HDC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042851: 71%, ENSRNOG00000026277: 68%
Entrez Gene ID: 376940
Uniprot ID: P61129
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZC3H6
Alternative Gene Name: FLJ41410, FLJ45877, KIAA2035, ZC3HDC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042851: 71%, ENSRNOG00000026277: 68%
Entrez Gene ID: 376940
Uniprot ID: P61129
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ISGSYITSKKGQHNKKFKSKEYDEYSTYSDDNFGNYSDDNFGNYGQETEEDFANQLKQYRQAKETSNIALGSSFSKESGKKQRMKGVQQGI |
Documents & Links for Anti ZC3H6 pAb (ATL-HPA076065) | |
Datasheet | Anti ZC3H6 pAb (ATL-HPA076065) Datasheet (External Link) |
Vendor Page | Anti ZC3H6 pAb (ATL-HPA076065) at Atlas |
Documents & Links for Anti ZC3H6 pAb (ATL-HPA076065) | |
Datasheet | Anti ZC3H6 pAb (ATL-HPA076065) Datasheet (External Link) |
Vendor Page | Anti ZC3H6 pAb (ATL-HPA076065) |