Anti ZC3H18 pAb (ATL-HPA041327 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA041327-25

• 
• 

Product Description

Protein Description: zinc finger CCCH-type containing 18
Gene Name: ZC3H18
Alternative Gene Name: NHN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017478: 96%, ENSRNOG00000028501: 96%
Entrez Gene ID: 124245
Uniprot ID: Q86VM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRIPRDVRDTVLEPYADPYYDYEIERFWRGGQYENFRV
• Gene Sequence: QEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRIPRDVRDTVLEPYADPYYDYEIERFWRGGQYENFRV
• Gene ID - Mouse: ENSMUSG00000017478
• Gene ID - Rat: ENSRNOG00000028501
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.