Description
Product Description
Protein Description: zinc finger CCCH-type containing 18
Gene Name: ZC3H18
Alternative Gene Name: NHN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017478: 96%, ENSRNOG00000028501: 96%
Entrez Gene ID: 124245
Uniprot ID: Q86VM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZC3H18
Alternative Gene Name: NHN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017478: 96%, ENSRNOG00000028501: 96%
Entrez Gene ID: 124245
Uniprot ID: Q86VM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRIPRDVRDTVLEPYADPYYDYEIERFWRGGQYENFRV |
Gene Sequence | QEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRIPRDVRDTVLEPYADPYYDYEIERFWRGGQYENFRV |
Gene ID - Mouse | ENSMUSG00000017478 |
Gene ID - Rat | ENSRNOG00000028501 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZC3H18 pAb (ATL-HPA041327 w/enhanced validation) | |
Datasheet | Anti ZC3H18 pAb (ATL-HPA041327 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ZC3H18 pAb (ATL-HPA041327 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ZC3H18 pAb (ATL-HPA041327 w/enhanced validation) | |
Datasheet | Anti ZC3H18 pAb (ATL-HPA041327 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ZC3H18 pAb (ATL-HPA041327 w/enhanced validation) |