Anti ZC3H10 pAb (ATL-HPA062265)

Catalog No:
ATL-HPA062265-25
$303.00

Description

Product Description

Protein Description: zinc finger CCCH-type containing 10
Gene Name: ZC3H10
Alternative Gene Name: FLJ14451, ZC3HDC10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039810: 91%, ENSRNOG00000040281: 91%
Entrez Gene ID: 84872
Uniprot ID: Q96K80
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGGCCPPDGPHFESYEYSLAPPRGVECRLLEEENAMLRKRVEEL
Gene Sequence RGGCCPPDGPHFESYEYSLAPPRGVECRLLEEENAMLRKRVEEL
Gene ID - Mouse ENSMUSG00000039810
Gene ID - Rat ENSRNOG00000040281
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZC3H10 pAb (ATL-HPA062265)
Datasheet Anti ZC3H10 pAb (ATL-HPA062265) Datasheet (External Link)
Vendor Page Anti ZC3H10 pAb (ATL-HPA062265) at Atlas Antibodies

Documents & Links for Anti ZC3H10 pAb (ATL-HPA062265)
Datasheet Anti ZC3H10 pAb (ATL-HPA062265) Datasheet (External Link)
Vendor Page Anti ZC3H10 pAb (ATL-HPA062265)

Product Description

Protein Description: zinc finger CCCH-type containing 10
Gene Name: ZC3H10
Alternative Gene Name: FLJ14451, ZC3HDC10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039810: 91%, ENSRNOG00000040281: 91%
Entrez Gene ID: 84872
Uniprot ID: Q96K80
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGGCCPPDGPHFESYEYSLAPPRGVECRLLEEENAMLRKRVEEL
Gene Sequence RGGCCPPDGPHFESYEYSLAPPRGVECRLLEEENAMLRKRVEEL
Gene ID - Mouse ENSMUSG00000039810
Gene ID - Rat ENSRNOG00000040281
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ZC3H10 pAb (ATL-HPA062265)
Datasheet Anti ZC3H10 pAb (ATL-HPA062265) Datasheet (External Link)
Vendor Page Anti ZC3H10 pAb (ATL-HPA062265) at Atlas Antibodies

Documents & Links for Anti ZC3H10 pAb (ATL-HPA062265)
Datasheet Anti ZC3H10 pAb (ATL-HPA062265) Datasheet (External Link)
Vendor Page Anti ZC3H10 pAb (ATL-HPA062265)