Protein Description: zinc finger CCCH-type containing 10
Gene Name: ZC3H10
Alternative Gene Name: FLJ14451, ZC3HDC10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039810: 91%, ENSRNOG00000040281: 91%
Entrez Gene ID: 84872
Uniprot ID: Q96K80
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZC3H10
Alternative Gene Name: FLJ14451, ZC3HDC10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039810: 91%, ENSRNOG00000040281: 91%
Entrez Gene ID: 84872
Uniprot ID: Q96K80
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RGGCCPPDGPHFESYEYSLAPPRGVECRLLEEENAMLRKRVEEL |
| Documents & Links for Anti ZC3H10 pAb (ATL-HPA062265) | |
| Datasheet | Anti ZC3H10 pAb (ATL-HPA062265) Datasheet (External Link) |
| Vendor Page | Anti ZC3H10 pAb (ATL-HPA062265) at Atlas |
| Documents & Links for Anti ZC3H10 pAb (ATL-HPA062265) | |
| Datasheet | Anti ZC3H10 pAb (ATL-HPA062265) Datasheet (External Link) |
| Vendor Page | Anti ZC3H10 pAb (ATL-HPA062265) |