Description
Product Description
Protein Description: zinc finger C2HC-type containing 1C
Gene Name: ZC2HC1C
Alternative Gene Name: C14orf140, FAM164C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045064: 62%, ENSRNOG00000027115: 63%
Entrez Gene ID: 79696
Uniprot ID: Q53FD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZC2HC1C
Alternative Gene Name: C14orf140, FAM164C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045064: 62%, ENSRNOG00000027115: 63%
Entrez Gene ID: 79696
Uniprot ID: Q53FD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEWVQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQK |
Gene Sequence | SRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEWVQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQK |
Gene ID - Mouse | ENSMUSG00000045064 |
Gene ID - Rat | ENSRNOG00000027115 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZC2HC1C pAb (ATL-HPA065062 w/enhanced validation) | |
Datasheet | Anti ZC2HC1C pAb (ATL-HPA065062 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ZC2HC1C pAb (ATL-HPA065062 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ZC2HC1C pAb (ATL-HPA065062 w/enhanced validation) | |
Datasheet | Anti ZC2HC1C pAb (ATL-HPA065062 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ZC2HC1C pAb (ATL-HPA065062 w/enhanced validation) |