Polyclonal Antibody against Human ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Validated applications: ICC, Uniprot ID: Q8NAP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP |
Gene ID - Mouse | ENSMUSG00000048485 |
Gene ID - Rat | ENSMUSG00000048485 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti-ZBTB8B pAb (ATL-HPA071427) | |
Vendor Page | Anti-ZBTB8B pAb (ATL-HPA071427) at Atlas |
Documents & Links for Anti-ZBTB8B pAb (ATL-HPA071427) | |
Vendor Page | Anti-ZBTB8B pAb (ATL-HPA071427) |