Polyclonal Antibody against Human ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Validated applications: ICC, Uniprot ID: Q8NAP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications |
| Application |
ICC |
| Reactivity |
Human |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene Sequence |
AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP |
| Gene ID - Mouse |
ENSMUSG00000048485 |
| Gene ID - Rat |
ENSMUSG00000048485 |
| Buffer |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
