Protein Description: zinc finger and BTB domain containing 6
Gene Name: ZBTB6
Alternative Gene Name: ZID, ZNF482
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066798: 88%, ENSRNOG00000009340: 86%
Entrez Gene ID: 10773
Uniprot ID: Q15916
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZBTB6
Alternative Gene Name: ZID, ZNF482
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066798: 88%, ENSRNOG00000009340: 86%
Entrez Gene ID: 10773
Uniprot ID: Q15916
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EGSYGTVSEIQNLEEGYSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQC |
| Documents & Links for Anti ZBTB6 pAb (ATL-HPA076894) | |
| Datasheet | Anti ZBTB6 pAb (ATL-HPA076894) Datasheet (External Link) |
| Vendor Page | Anti ZBTB6 pAb (ATL-HPA076894) at Atlas |
| Documents & Links for Anti ZBTB6 pAb (ATL-HPA076894) | |
| Datasheet | Anti ZBTB6 pAb (ATL-HPA076894) Datasheet (External Link) |
| Vendor Page | Anti ZBTB6 pAb (ATL-HPA076894) |