Anti ZBTB6 pAb (ATL-HPA076894)

Catalog No:
ATL-HPA076894-25
$447.00
Protein Description: zinc finger and BTB domain containing 6
Gene Name: ZBTB6
Alternative Gene Name: ZID, ZNF482
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066798: 88%, ENSRNOG00000009340: 86%
Entrez Gene ID: 10773
Uniprot ID: Q15916
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence EGSYGTVSEIQNLEEGYSLRHQCPRCPRGFLHVENYLRHLKMHKLFLCLQC
Gene ID - Mouse ENSMUSG00000066798
Gene ID - Rat ENSMUSG00000066798
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti ZBTB6 pAb (ATL-HPA076894)
Datasheet Anti ZBTB6 pAb (ATL-HPA076894) Datasheet (External Link)
Vendor Page Anti ZBTB6 pAb (ATL-HPA076894) at Atlas

Documents & Links for Anti ZBTB6 pAb (ATL-HPA076894)
Datasheet Anti ZBTB6 pAb (ATL-HPA076894) Datasheet (External Link)
Vendor Page Anti ZBTB6 pAb (ATL-HPA076894)