Description
Product Description
Protein Description: zinc finger and BTB domain containing 47
Gene Name: ZBTB47
Alternative Gene Name: DKFZp434N0615, KIAA1190, ZNF651
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013419: 60%, ENSRNOG00000019382: 60%
Entrez Gene ID: 92999
Uniprot ID: Q9UFB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZBTB47
Alternative Gene Name: DKFZp434N0615, KIAA1190, ZNF651
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013419: 60%, ENSRNOG00000019382: 60%
Entrez Gene ID: 92999
Uniprot ID: Q9UFB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EAGGKQGPRGSRSSRADPPPHSHMATRSRENARRRGTPEPEEAGRRGGKRPKPPPGVASASARG |
Gene Sequence | EAGGKQGPRGSRSSRADPPPHSHMATRSRENARRRGTPEPEEAGRRGGKRPKPPPGVASASARG |
Gene ID - Mouse | ENSMUSG00000013419 |
Gene ID - Rat | ENSRNOG00000019382 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZBTB47 pAb (ATL-HPA074057) | |
Datasheet | Anti ZBTB47 pAb (ATL-HPA074057) Datasheet (External Link) |
Vendor Page | Anti ZBTB47 pAb (ATL-HPA074057) at Atlas Antibodies |
Documents & Links for Anti ZBTB47 pAb (ATL-HPA074057) | |
Datasheet | Anti ZBTB47 pAb (ATL-HPA074057) Datasheet (External Link) |
Vendor Page | Anti ZBTB47 pAb (ATL-HPA074057) |