Protein Description: zinc finger and BTB domain containing 47
Gene Name: ZBTB47
Alternative Gene Name: DKFZp434N0615, KIAA1190, ZNF651
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013419: 60%, ENSRNOG00000019382: 60%
Entrez Gene ID: 92999
Uniprot ID: Q9UFB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZBTB47
Alternative Gene Name: DKFZp434N0615, KIAA1190, ZNF651
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013419: 60%, ENSRNOG00000019382: 60%
Entrez Gene ID: 92999
Uniprot ID: Q9UFB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EAGGKQGPRGSRSSRADPPPHSHMATRSRENARRRGTPEPEEAGRRGGKRPKPPPGVASASARG |
| Documents & Links for Anti ZBTB47 pAb (ATL-HPA074057) | |
| Datasheet | Anti ZBTB47 pAb (ATL-HPA074057) Datasheet (External Link) |
| Vendor Page | Anti ZBTB47 pAb (ATL-HPA074057) at Atlas |
| Documents & Links for Anti ZBTB47 pAb (ATL-HPA074057) | |
| Datasheet | Anti ZBTB47 pAb (ATL-HPA074057) Datasheet (External Link) |
| Vendor Page | Anti ZBTB47 pAb (ATL-HPA074057) |