Protein Description: zinc finger and BTB domain containing 45
Gene Name: ZBTB45
Alternative Gene Name: FLJ14486, ZNF499
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049600: 78%, ENSRNOG00000027459: 80%
Entrez Gene ID: 84878
Uniprot ID: Q96K62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZBTB45
Alternative Gene Name: FLJ14486, ZNF499
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049600: 78%, ENSRNOG00000027459: 80%
Entrez Gene ID: 84878
Uniprot ID: Q96K62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | APPSFPDCAAGFLTAAADSACEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWH |
Documents & Links for Anti ZBTB45 pAb (ATL-HPA075485) | |
Datasheet | Anti ZBTB45 pAb (ATL-HPA075485) Datasheet (External Link) |
Vendor Page | Anti ZBTB45 pAb (ATL-HPA075485) at Atlas |
Documents & Links for Anti ZBTB45 pAb (ATL-HPA075485) | |
Datasheet | Anti ZBTB45 pAb (ATL-HPA075485) Datasheet (External Link) |
Vendor Page | Anti ZBTB45 pAb (ATL-HPA075485) |