Protein Description: zinc finger and BTB domain containing 4
Gene Name: ZBTB4
Alternative Gene Name: KAISO-L1, KIAA1538, ZNF903
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018750: 88%, ENSRNOG00000014689: 86%
Entrez Gene ID: 57659
Uniprot ID: Q9P1Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZBTB4
Alternative Gene Name: KAISO-L1, KIAA1538, ZNF903
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018750: 88%, ENSRNOG00000014689: 86%
Entrez Gene ID: 57659
Uniprot ID: Q9P1Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGEAGGGSTAAEEASETASLQDPIISGGEEPPVVASGGSYVYPPV |
| Documents & Links for Anti ZBTB4 pAb (ATL-HPA064763) | |
| Datasheet | Anti ZBTB4 pAb (ATL-HPA064763) Datasheet (External Link) |
| Vendor Page | Anti ZBTB4 pAb (ATL-HPA064763) at Atlas |
| Documents & Links for Anti ZBTB4 pAb (ATL-HPA064763) | |
| Datasheet | Anti ZBTB4 pAb (ATL-HPA064763) Datasheet (External Link) |
| Vendor Page | Anti ZBTB4 pAb (ATL-HPA064763) |