Anti ZBTB2 pAb (ATL-HPA023136 w/enhanced validation)

Atlas

Catalog No: ATL-HPA023136-25

• 
• 

Protein Description: zinc finger and BTB domain containing 2
Gene Name: ZBTB2
Alternative Gene Name: bA351K16.2, KIAA1483, ZNF437
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075327: 97%, ENSRNOG00000019544: 97%
Entrez Gene ID: 57621
Uniprot ID: Q8N680
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: IFSYLLHLMYTGKMAPQLIDPVRLEQGIKFLHAYPLIQEASLASQGAFSHPDQVFPLASSLYGIQIADHQLR