![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101231/181305/atl-hpa074019_anti-zbtb18-pab-atl-hpa074019-wenhanced-validation_62973__18903.1681137603.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: zinc finger and BTB domain containing 18
Gene Name: ZBTB18
Alternative Gene Name: C2H2-171, RP58, TAZ-1, ZNF238
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063659: 97%, ENSRNOG00000004423: 95%
Entrez Gene ID: 10472
Uniprot ID: Q99592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZBTB18
Alternative Gene Name: C2H2-171, RP58, TAZ-1, ZNF238
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063659: 97%, ENSRNOG00000004423: 95%
Entrez Gene ID: 10472
Uniprot ID: Q99592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGI |
| Documents & Links for Anti ZBTB18 pAb (ATL-HPA074019 w/enhanced validation) | |
| Datasheet | Anti ZBTB18 pAb (ATL-HPA074019 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ZBTB18 pAb (ATL-HPA074019 w/enhanced validation) at Atlas |
| Documents & Links for Anti ZBTB18 pAb (ATL-HPA074019 w/enhanced validation) | |
| Datasheet | Anti ZBTB18 pAb (ATL-HPA074019 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ZBTB18 pAb (ATL-HPA074019 w/enhanced validation) |