Anti ZBTB18 pAb (ATL-HPA074019 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA074019-25

• 
• 

Product Description

Protein Description: zinc finger and BTB domain containing 18
Gene Name: ZBTB18
Alternative Gene Name: C2H2-171, RP58, TAZ-1, ZNF238
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063659: 97%, ENSRNOG00000004423: 95%
Entrez Gene ID: 10472
Uniprot ID: Q99592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGI
• Gene Sequence: EDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGI
• Gene ID - Mouse: ENSMUSG00000063659
• Gene ID - Rat: ENSRNOG00000004423
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.