Description
Product Description
Protein Description: zinc finger and BTB domain containing 18
Gene Name: ZBTB18
Alternative Gene Name: C2H2-171, RP58, TAZ-1, ZNF238
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063659: 97%, ENSRNOG00000004423: 95%
Entrez Gene ID: 10472
Uniprot ID: Q99592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZBTB18
Alternative Gene Name: C2H2-171, RP58, TAZ-1, ZNF238
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063659: 97%, ENSRNOG00000004423: 95%
Entrez Gene ID: 10472
Uniprot ID: Q99592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGI |
Gene Sequence | EDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGI |
Gene ID - Mouse | ENSMUSG00000063659 |
Gene ID - Rat | ENSRNOG00000004423 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZBTB18 pAb (ATL-HPA074019 w/enhanced validation) | |
Datasheet | Anti ZBTB18 pAb (ATL-HPA074019 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ZBTB18 pAb (ATL-HPA074019 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ZBTB18 pAb (ATL-HPA074019 w/enhanced validation) | |
Datasheet | Anti ZBTB18 pAb (ATL-HPA074019 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ZBTB18 pAb (ATL-HPA074019 w/enhanced validation) |