Description
Product Description
Protein Description: zinc finger and BTB domain containing 1
Gene Name: ZBTB1
Alternative Gene Name: KIAA0997, ZNF909
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033454: 100%, ENSRNOG00000058593: 97%
Entrez Gene ID: 22890
Uniprot ID: Q9Y2K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZBTB1
Alternative Gene Name: KIAA0997, ZNF909
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033454: 100%, ENSRNOG00000058593: 97%
Entrez Gene ID: 22890
Uniprot ID: Q9Y2K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MNHQHSTAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVPDCLEDIQDADCSSS |
Gene Sequence | MNHQHSTAQLNLSNMKISAECFDLILQFMYLGKIMTAPSSFEQFKVAMNYLQLYNVPDCLEDIQDADCSSS |
Gene ID - Mouse | ENSMUSG00000033454 |
Gene ID - Rat | ENSRNOG00000058593 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ZBTB1 pAb (ATL-HPA075151) | |
Datasheet | Anti ZBTB1 pAb (ATL-HPA075151) Datasheet (External Link) |
Vendor Page | Anti ZBTB1 pAb (ATL-HPA075151) at Atlas Antibodies |
Documents & Links for Anti ZBTB1 pAb (ATL-HPA075151) | |
Datasheet | Anti ZBTB1 pAb (ATL-HPA075151) Datasheet (External Link) |
Vendor Page | Anti ZBTB1 pAb (ATL-HPA075151) |