Anti ZBED6 pAb (ATL-HPA068807)

Atlas Antibodies

Catalog No: ATL-HPA068807-25

• 

Product Description

Protein Description: zinc finger, BED-type containing 6
Gene Name: ZBED6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102049: 95%, ENSRNOG00000061499: 27%
Entrez Gene ID: 100381270
Uniprot ID: P86452
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFSKDLGSGRPVADAPALLASNDPEQDEESLFESNIEKQIYLPSTRAKTSIVWHFFHVDPQYTWRAICNLCEKSVSRGKPGSHLGTS
• Gene Sequence: KFSKDLGSGRPVADAPALLASNDPEQDEESLFESNIEKQIYLPSTRAKTSIVWHFFHVDPQYTWRAICNLCEKSVSRGKPGSHLGTS
• Gene ID - Mouse: ENSMUSG00000102049
• Gene ID - Rat: ENSRNOG00000061499
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti ZBED6 pAb (ATL-HPA068807) – 4 Found

Wang, Dandan; Pu, Yabin; Li, Yefang; Pan, Dengke; Wang, Shengnan; Tian, Wenjie; Ma, Yuehui; Jiang, Lin. Comprehensive analysis of lncRNAs involved in skeletal muscle development in ZBED6-knockout Bama pigs. Bmc Genomics. 2021;22(1):593. 

Wang, Dandan; Pan, Dengke; Xie, Baocai; Wang, Shengnan; Xing, Xiangyang; Liu, Xuexue; Ma, Yuehui; Andersson, Leif; Wu, Jiangwei; Jiang, Lin. Porcine ZBED6 regulates growth of skeletal muscle and internal organs via multiple targets. Plos Genetics. 2021;17(10):e1009862. 

Wang, Shengnan; Tian, Wenjie; Pan, Dengke; Liu, Ling; Xu, Cheng; Ma, Yuehui; Wang, Dandan; Jiang, Lin. A Comprehensive Analysis of the Myocardial Transcriptome in ZBED6-Knockout Bama Xiang Pigs. Genes. 2022;13(8) 

Liu, Ling; Wang, Shengnan; Tian, Wenjie; Xu, Cheng; Wei, Chengjie; Cui, Kai; Jiang, Lin; Wang, Dandan. Effect of Zbed6 Single-Allele Knockout on the Growth and Development of Skeletal Muscle in Mice. Biology. 2023;12(2)