Anti ZBED3 pAb (ATL-HPA055995)

Atlas Antibodies

Catalog No: ATL-HPA055995-25

• 
• 

Product Description

Protein Description: zinc finger, BED-type containing 3
Gene Name: ZBED3
Alternative Gene Name: MGC15435
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038838: 31%, ENSRNOG00000028941: 40%
Entrez Gene ID: 84327
Uniprot ID: Q96IU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RELQAEREALQARLRDVSRREGALGWAPAAPPPLKDDPEGDRDGCVITKVLL
• Gene Sequence: RELQAEREALQARLRDVSRREGALGWAPAAPPPLKDDPEGDRDGCVITKVLL
• Gene ID - Mouse: ENSMUSG00000038838
• Gene ID - Rat: ENSRNOG00000028941
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.