Anti YME1L1 pAb (ATL-HPA066953)

Atlas Antibodies

Catalog No: ATL-HPA066953-25

• 
• 

Product Description

Protein Description: YME1-like 1 ATPase
Gene Name: YME1L1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026775: 100%, ENSRNOG00000055012: 100%
Entrez Gene ID: 10730
Uniprot ID: Q96TA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHESGHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQMDVS
• Gene Sequence: AVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHESGHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQMDVS
• Gene ID - Mouse: ENSMUSG00000026775
• Gene ID - Rat: ENSRNOG00000055012
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.