Protein Description: YME1-like 1 ATPase
Gene Name: YME1L1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026775: 100%, ENSRNOG00000055012: 100%
Entrez Gene ID: 10730
Uniprot ID: Q96TA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: YME1L1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026775: 100%, ENSRNOG00000055012: 100%
Entrez Gene ID: 10730
Uniprot ID: Q96TA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHESGHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQMDVS |
| Documents & Links for Anti YME1L1 pAb (ATL-HPA066953) | |
| Datasheet | Anti YME1L1 pAb (ATL-HPA066953) Datasheet (External Link) |
| Vendor Page | Anti YME1L1 pAb (ATL-HPA066953) at Atlas |
| Documents & Links for Anti YME1L1 pAb (ATL-HPA066953) | |
| Datasheet | Anti YME1L1 pAb (ATL-HPA066953) Datasheet (External Link) |
| Vendor Page | Anti YME1L1 pAb (ATL-HPA066953) |