Description
Product Description
Protein Description: YLP motif containing 1
Gene Name: YLPM1
Alternative Gene Name: C14orf170, PPP1R169, ZAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021244: 85%, ENSRNOG00000027317: 84%
Entrez Gene ID: 56252
Uniprot ID: P49750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: YLPM1
Alternative Gene Name: C14orf170, PPP1R169, ZAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021244: 85%, ENSRNOG00000027317: 84%
Entrez Gene ID: 56252
Uniprot ID: P49750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SGNKEPLADTSSNQQKNFKMQSAAFSIAADVKDVKAAQSNENLSDSQQEPPKSEVSEGPVEPSNWDQNVQSMETQIDKAQAVTQPVPLANKPVPAQST |
Gene Sequence | SGNKEPLADTSSNQQKNFKMQSAAFSIAADVKDVKAAQSNENLSDSQQEPPKSEVSEGPVEPSNWDQNVQSMETQIDKAQAVTQPVPLANKPVPAQST |
Gene ID - Mouse | ENSMUSG00000021244 |
Gene ID - Rat | ENSRNOG00000027317 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti YLPM1 pAb (ATL-HPA061123 w/enhanced validation) | |
Datasheet | Anti YLPM1 pAb (ATL-HPA061123 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti YLPM1 pAb (ATL-HPA061123 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti YLPM1 pAb (ATL-HPA061123 w/enhanced validation) | |
Datasheet | Anti YLPM1 pAb (ATL-HPA061123 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti YLPM1 pAb (ATL-HPA061123 w/enhanced validation) |