Description
Product Description
Protein Description: Yip1 domain family, member 5
Gene Name: YIPF5
Alternative Gene Name: FinGER5, SMAP-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024487: 91%, ENSRNOG00000014564: 89%
Entrez Gene ID: 81555
Uniprot ID: Q969M3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: YIPF5
Alternative Gene Name: FinGER5, SMAP-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024487: 91%, ENSRNOG00000014564: 89%
Entrez Gene ID: 81555
Uniprot ID: Q969M3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPD |
Gene Sequence | SGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPD |
Gene ID - Mouse | ENSMUSG00000024487 |
Gene ID - Rat | ENSRNOG00000014564 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti YIPF5 pAb (ATL-HPA073622 w/enhanced validation) | |
Datasheet | Anti YIPF5 pAb (ATL-HPA073622 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti YIPF5 pAb (ATL-HPA073622 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti YIPF5 pAb (ATL-HPA073622 w/enhanced validation) | |
Datasheet | Anti YIPF5 pAb (ATL-HPA073622 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti YIPF5 pAb (ATL-HPA073622 w/enhanced validation) |