Description
Product Description
Protein Description: Yip1 domain family, member 3
Gene Name: YIPF3
Alternative Gene Name: C6orf109, dJ337H4.3, DKFZp566C243, FinGER3, KLIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071074: 94%, ENSRNOG00000018998: 94%
Entrez Gene ID: 25844
Uniprot ID: Q9GZM5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: YIPF3
Alternative Gene Name: C6orf109, dJ337H4.3, DKFZp566C243, FinGER3, KLIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071074: 94%, ENSRNOG00000018998: 94%
Entrez Gene ID: 25844
Uniprot ID: Q9GZM5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREEEVDADAADAAAAEEEDGEFLGM |
Gene Sequence | ARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREEEVDADAADAAAAEEEDGEFLGM |
Gene ID - Mouse | ENSMUSG00000071074 |
Gene ID - Rat | ENSRNOG00000018998 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti YIPF3 pAb (ATL-HPA063699) | |
Datasheet | Anti YIPF3 pAb (ATL-HPA063699) Datasheet (External Link) |
Vendor Page | Anti YIPF3 pAb (ATL-HPA063699) at Atlas Antibodies |
Documents & Links for Anti YIPF3 pAb (ATL-HPA063699) | |
Datasheet | Anti YIPF3 pAb (ATL-HPA063699) Datasheet (External Link) |
Vendor Page | Anti YIPF3 pAb (ATL-HPA063699) |