Anti YIPF3 pAb (ATL-HPA063699)

Catalog No:
ATL-HPA063699-25
$303.00

Description

Product Description

Protein Description: Yip1 domain family, member 3
Gene Name: YIPF3
Alternative Gene Name: C6orf109, dJ337H4.3, DKFZp566C243, FinGER3, KLIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071074: 94%, ENSRNOG00000018998: 94%
Entrez Gene ID: 25844
Uniprot ID: Q9GZM5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREEEVDADAADAAAAEEEDGEFLGM
Gene Sequence ARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREEEVDADAADAAAAEEEDGEFLGM
Gene ID - Mouse ENSMUSG00000071074
Gene ID - Rat ENSRNOG00000018998
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti YIPF3 pAb (ATL-HPA063699)
Datasheet Anti YIPF3 pAb (ATL-HPA063699) Datasheet (External Link)
Vendor Page Anti YIPF3 pAb (ATL-HPA063699) at Atlas Antibodies

Documents & Links for Anti YIPF3 pAb (ATL-HPA063699)
Datasheet Anti YIPF3 pAb (ATL-HPA063699) Datasheet (External Link)
Vendor Page Anti YIPF3 pAb (ATL-HPA063699)

Product Description

Protein Description: Yip1 domain family, member 3
Gene Name: YIPF3
Alternative Gene Name: C6orf109, dJ337H4.3, DKFZp566C243, FinGER3, KLIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071074: 94%, ENSRNOG00000018998: 94%
Entrez Gene ID: 25844
Uniprot ID: Q9GZM5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREEEVDADAADAAAAEEEDGEFLGM
Gene Sequence ARNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREEEVDADAADAAAAEEEDGEFLGM
Gene ID - Mouse ENSMUSG00000071074
Gene ID - Rat ENSRNOG00000018998
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti YIPF3 pAb (ATL-HPA063699)
Datasheet Anti YIPF3 pAb (ATL-HPA063699) Datasheet (External Link)
Vendor Page Anti YIPF3 pAb (ATL-HPA063699) at Atlas Antibodies

Documents & Links for Anti YIPF3 pAb (ATL-HPA063699)
Datasheet Anti YIPF3 pAb (ATL-HPA063699) Datasheet (External Link)
Vendor Page Anti YIPF3 pAb (ATL-HPA063699)