Protein Description: YEATS domain containing 4
Gene Name: YEATS4
Alternative Gene Name: GAS41, NuBI-1, YAF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020171: 99%, ENSRNOG00000005689: 96%
Entrez Gene ID: 8089
Uniprot ID: O95619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: YEATS4
Alternative Gene Name: GAS41, NuBI-1, YAF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020171: 99%, ENSRNOG00000005689: 96%
Entrez Gene ID: 8089
Uniprot ID: O95619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKD |
| Documents & Links for Anti YEATS4 pAb (ATL-HPA072532) | |
| Datasheet | Anti YEATS4 pAb (ATL-HPA072532) Datasheet (External Link) |
| Vendor Page | Anti YEATS4 pAb (ATL-HPA072532) at Atlas |
| Documents & Links for Anti YEATS4 pAb (ATL-HPA072532) | |
| Datasheet | Anti YEATS4 pAb (ATL-HPA072532) Datasheet (External Link) |
| Vendor Page | Anti YEATS4 pAb (ATL-HPA072532) |