Protein Description: tyrosyl-tRNA synthetase 2, mitochondrial
Gene Name: YARS2
Alternative Gene Name: CGI-04, FLJ13995, mt-TyrRS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022792: 90%, ENSRNOG00000025252: 90%
Entrez Gene ID: 51067
Uniprot ID: Q9Y2Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: YARS2
Alternative Gene Name: CGI-04, FLJ13995, mt-TyrRS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022792: 90%, ENSRNOG00000025252: 90%
Entrez Gene ID: 51067
Uniprot ID: Q9Y2Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DALEVMSDQELKELFKEAPFSEFFLDPGTSVLDTCRKANAIPDGPRGYRMITEGGVSINHQQVTNPESVLIVGQHILKNGLSL |
| Documents & Links for Anti YARS2 pAb (ATL-HPA074097) | |
| Datasheet | Anti YARS2 pAb (ATL-HPA074097) Datasheet (External Link) |
| Vendor Page | Anti YARS2 pAb (ATL-HPA074097) at Atlas |
| Documents & Links for Anti YARS2 pAb (ATL-HPA074097) | |
| Datasheet | Anti YARS2 pAb (ATL-HPA074097) Datasheet (External Link) |
| Vendor Page | Anti YARS2 pAb (ATL-HPA074097) |