Protein Description: X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
Gene Name: XRCC5
Alternative Gene Name: KARP-1, KU80, Ku86, KUB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026187: 85%, ENSRNOG00000016105: 83%
Entrez Gene ID: 7520
Uniprot ID: P13010
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: XRCC5
Alternative Gene Name: KARP-1, KU80, Ku86, KUB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026187: 85%, ENSRNOG00000016105: 83%
Entrez Gene ID: 7520
Uniprot ID: P13010
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQD |
Documents & Links for Anti XRCC5 pAb (ATL-HPA064685) | |
Datasheet | Anti XRCC5 pAb (ATL-HPA064685) Datasheet (External Link) |
Vendor Page | Anti XRCC5 pAb (ATL-HPA064685) at Atlas |
Documents & Links for Anti XRCC5 pAb (ATL-HPA064685) | |
Datasheet | Anti XRCC5 pAb (ATL-HPA064685) Datasheet (External Link) |
Vendor Page | Anti XRCC5 pAb (ATL-HPA064685) |