Anti XRCC3 pAb (ATL-HPA068953)

Catalog No:
ATL-HPA068953-25
$395.00

Description

Product Description

Protein Description: X-ray repair complementing defective repair in Chinese hamster cells 3
Gene Name: XRCC3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021287: 85%, ENSRNOG00000012141: 84%
Entrez Gene ID: 7517
Uniprot ID: O43542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDV
Gene Sequence TQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDV
Gene ID - Mouse ENSMUSG00000021287
Gene ID - Rat ENSRNOG00000012141
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti XRCC3 pAb (ATL-HPA068953)
Datasheet Anti XRCC3 pAb (ATL-HPA068953) Datasheet (External Link)
Vendor Page Anti XRCC3 pAb (ATL-HPA068953) at Atlas Antibodies

Documents & Links for Anti XRCC3 pAb (ATL-HPA068953)
Datasheet Anti XRCC3 pAb (ATL-HPA068953) Datasheet (External Link)
Vendor Page Anti XRCC3 pAb (ATL-HPA068953)

Product Description

Protein Description: X-ray repair complementing defective repair in Chinese hamster cells 3
Gene Name: XRCC3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021287: 85%, ENSRNOG00000012141: 84%
Entrez Gene ID: 7517
Uniprot ID: O43542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDV
Gene Sequence TQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDV
Gene ID - Mouse ENSMUSG00000021287
Gene ID - Rat ENSRNOG00000012141
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti XRCC3 pAb (ATL-HPA068953)
Datasheet Anti XRCC3 pAb (ATL-HPA068953) Datasheet (External Link)
Vendor Page Anti XRCC3 pAb (ATL-HPA068953) at Atlas Antibodies

Documents & Links for Anti XRCC3 pAb (ATL-HPA068953)
Datasheet Anti XRCC3 pAb (ATL-HPA068953) Datasheet (External Link)
Vendor Page Anti XRCC3 pAb (ATL-HPA068953)