Protein Description: X-ray repair complementing defective repair in Chinese hamster cells 3
Gene Name: XRCC3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021287: 85%, ENSRNOG00000012141: 84%
Entrez Gene ID: 7517
Uniprot ID: O43542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: XRCC3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021287: 85%, ENSRNOG00000012141: 84%
Entrez Gene ID: 7517
Uniprot ID: O43542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDV |
| Documents & Links for Anti XRCC3 pAb (ATL-HPA068953) | |
| Datasheet | Anti XRCC3 pAb (ATL-HPA068953) Datasheet (External Link) |
| Vendor Page | Anti XRCC3 pAb (ATL-HPA068953) at Atlas |
| Documents & Links for Anti XRCC3 pAb (ATL-HPA068953) | |
| Datasheet | Anti XRCC3 pAb (ATL-HPA068953) Datasheet (External Link) |
| Vendor Page | Anti XRCC3 pAb (ATL-HPA068953) |