Protein Description: X-ray repair complementing defective repair in Chinese hamster cells 2
Gene Name: XRCC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028933: 76%, ENSRNOG00000007493: 77%
Entrez Gene ID: 7516
Uniprot ID: O43543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: XRCC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028933: 76%, ENSRNOG00000007493: 77%
Entrez Gene ID: 7516
Uniprot ID: O43543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AQLVNGVGGGKVESLLRRAFGAMCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYC |
| Documents & Links for Anti XRCC2 pAb (ATL-HPA065153) | |
| Datasheet | Anti XRCC2 pAb (ATL-HPA065153) Datasheet (External Link) |
| Vendor Page | Anti XRCC2 pAb (ATL-HPA065153) at Atlas |
| Documents & Links for Anti XRCC2 pAb (ATL-HPA065153) | |
| Datasheet | Anti XRCC2 pAb (ATL-HPA065153) Datasheet (External Link) |
| Vendor Page | Anti XRCC2 pAb (ATL-HPA065153) |