Anti XRCC2 pAb (ATL-HPA065153)

Catalog No:
ATL-HPA065153-25
$395.00

Description

Product Description

Protein Description: X-ray repair complementing defective repair in Chinese hamster cells 2
Gene Name: XRCC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028933: 76%, ENSRNOG00000007493: 77%
Entrez Gene ID: 7516
Uniprot ID: O43543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQLVNGVGGGKVESLLRRAFGAMCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYC
Gene Sequence AQLVNGVGGGKVESLLRRAFGAMCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYC
Gene ID - Mouse ENSMUSG00000028933
Gene ID - Rat ENSRNOG00000007493
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti XRCC2 pAb (ATL-HPA065153)
Datasheet Anti XRCC2 pAb (ATL-HPA065153) Datasheet (External Link)
Vendor Page Anti XRCC2 pAb (ATL-HPA065153) at Atlas Antibodies

Documents & Links for Anti XRCC2 pAb (ATL-HPA065153)
Datasheet Anti XRCC2 pAb (ATL-HPA065153) Datasheet (External Link)
Vendor Page Anti XRCC2 pAb (ATL-HPA065153)

Product Description

Protein Description: X-ray repair complementing defective repair in Chinese hamster cells 2
Gene Name: XRCC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028933: 76%, ENSRNOG00000007493: 77%
Entrez Gene ID: 7516
Uniprot ID: O43543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQLVNGVGGGKVESLLRRAFGAMCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYC
Gene Sequence AQLVNGVGGGKVESLLRRAFGAMCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYC
Gene ID - Mouse ENSMUSG00000028933
Gene ID - Rat ENSRNOG00000007493
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti XRCC2 pAb (ATL-HPA065153)
Datasheet Anti XRCC2 pAb (ATL-HPA065153) Datasheet (External Link)
Vendor Page Anti XRCC2 pAb (ATL-HPA065153) at Atlas Antibodies

Documents & Links for Anti XRCC2 pAb (ATL-HPA065153)
Datasheet Anti XRCC2 pAb (ATL-HPA065153) Datasheet (External Link)
Vendor Page Anti XRCC2 pAb (ATL-HPA065153)