Anti WRAP53 pAb (ATL-HPA023026 w/enhanced validation)

Atlas

Catalog No: ATL-HPA023026-100

• 
• 
• 

Protein Description: WD repeat containing, antisense to TP53
Gene Name: WRAP53
Alternative Gene Name: FLJ10385, TCAB1, WDR79
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041346: 80%, ENSRNOG00000010520: 81%
Entrez Gene ID: 55135
Uniprot ID: Q9BUR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Gene Sequence: GSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVEYAEMVPVLRMVEGDTIYDYC
• Gene ID - Mouse: ENSMUSG00000041346
• Gene ID - Rat: ENSMUSG00000041346
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WRAP53 pAb (ATL-HPA023026 w/enhanced validation) – 1 Found

Hedström, E; Pederiva, C; Farnebo, J; Nodin, B; Jirström, K; Brennan, D J; Farnebo, M. Downregulation of the cancer susceptibility protein WRAP53β in epithelial ovarian cancer leads to defective DNA repair and poor clinical outcome. Cell Death & Disease. 2015;6(10):e1892.