Anti WNT6 pAb (ATL-HPA070759)

Atlas Antibodies

Catalog No: ATL-HPA070759-25

• 

Product Description

Protein Description: Wnt family member 6
Gene Name: WNT6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033227: 98%, ENSRNOG00000017409: 98%
Entrez Gene ID: 7475
Uniprot ID: Q9Y6F9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNE
• Gene Sequence: WEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNE
• Gene ID - Mouse: ENSMUSG00000033227
• Gene ID - Rat: ENSRNOG00000017409
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.