Protein Description: wingless-type MMTV integration site family, member 11
Gene Name: WNT11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015957: 100%, ENSRNOG00000015982: 100%
Entrez Gene ID: 7481
Uniprot ID: O96014
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WNT11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015957: 100%, ENSRNOG00000015982: 100%
Entrez Gene ID: 7481
Uniprot ID: O96014
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSCD |
Documents & Links for Anti WNT11 pAb (ATL-HPA063569) | |
Datasheet | Anti WNT11 pAb (ATL-HPA063569) Datasheet (External Link) |
Vendor Page | Anti WNT11 pAb (ATL-HPA063569) at Atlas |
Documents & Links for Anti WNT11 pAb (ATL-HPA063569) | |
Datasheet | Anti WNT11 pAb (ATL-HPA063569) Datasheet (External Link) |
Vendor Page | Anti WNT11 pAb (ATL-HPA063569) |