Anti WNT11 pAb (ATL-HPA063569)

Catalog No:
ATL-HPA063569-25
$447.00

Description

Product Description

Protein Description: wingless-type MMTV integration site family, member 11
Gene Name: WNT11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015957: 100%, ENSRNOG00000015982: 100%
Entrez Gene ID: 7481
Uniprot ID: O96014
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSCD
Gene Sequence ATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSCD
Gene ID - Mouse ENSMUSG00000015957
Gene ID - Rat ENSRNOG00000015982
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti WNT11 pAb (ATL-HPA063569)
Datasheet Anti WNT11 pAb (ATL-HPA063569) Datasheet (External Link)
Vendor Page Anti WNT11 pAb (ATL-HPA063569) at Atlas Antibodies

Documents & Links for Anti WNT11 pAb (ATL-HPA063569)
Datasheet Anti WNT11 pAb (ATL-HPA063569) Datasheet (External Link)
Vendor Page Anti WNT11 pAb (ATL-HPA063569)

Product Description

Protein Description: wingless-type MMTV integration site family, member 11
Gene Name: WNT11
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015957: 100%, ENSRNOG00000015982: 100%
Entrez Gene ID: 7481
Uniprot ID: O96014
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSCD
Gene Sequence ATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSCD
Gene ID - Mouse ENSMUSG00000015957
Gene ID - Rat ENSRNOG00000015982
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti WNT11 pAb (ATL-HPA063569)
Datasheet Anti WNT11 pAb (ATL-HPA063569) Datasheet (External Link)
Vendor Page Anti WNT11 pAb (ATL-HPA063569) at Atlas Antibodies

Documents & Links for Anti WNT11 pAb (ATL-HPA063569)
Datasheet Anti WNT11 pAb (ATL-HPA063569) Datasheet (External Link)
Vendor Page Anti WNT11 pAb (ATL-HPA063569)