Anti WISP3 pAb (ATL-HPA062438)

Atlas Antibodies

Catalog No: ATL-HPA062438-25

• 

Product Description

Protein Description: WNT1 inducible signaling pathway protein 3
Gene Name: WISP3
Alternative Gene Name: CCN6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062074: 88%, ENSRNOG00000000597: 83%
Entrez Gene ID: 8838
Uniprot ID: O95389
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CQPTFQLSKAEKFVFSGCSSTQSYKPTFCGICLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWIT
• Gene Sequence: CQPTFQLSKAEKFVFSGCSSTQSYKPTFCGICLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWIT
• Gene ID - Mouse: ENSMUSG00000062074
• Gene ID - Rat: ENSRNOG00000000597
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.