Anti WIPF1 pAb (ATL-HPA070706)

Atlas Antibodies

Catalog No: ATL-HPA070706-25

• 

Product Description

Protein Description: WAS/WASL interacting protein family, member 1
Gene Name: WIPF1
Alternative Gene Name: WASPIP, WIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075284: 89%, ENSRNOG00000018406: 90%
Entrez Gene ID: 7456
Uniprot ID: O43516
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NRDNDSGGSRPPLLPPGGRSTSAKPFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSP
• Gene Sequence: NRDNDSGGSRPPLLPPGGRSTSAKPFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSP
• Gene ID - Mouse: ENSMUSG00000075284
• Gene ID - Rat: ENSRNOG00000018406
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.