Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA071119-25

• 

Product Description

Protein Description: WAP four-disulfide core domain 8
Gene Name: WFDC8
Alternative Gene Name: C20orf170, dJ461P17.1, WAP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070533: 73%, ENSRNOG00000014771: 73%
Entrez Gene ID: 90199
Uniprot ID: Q8IUA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQCPLFPFTERKECPPSCHSDIDCPQTDKCCESRCGFVCARAWTVKKGFCPRKPLLCTKIDKPKCLQDEECPLVEKCCSHCGLKCMDPR
• Gene Sequence: GQCPLFPFTERKECPPSCHSDIDCPQTDKCCESRCGFVCARAWTVKKGFCPRKPLLCTKIDKPKCLQDEECPLVEKCCSHCGLKCMDPR
• Gene ID - Mouse: ENSMUSG00000070533
• Gene ID - Rat: ENSRNOG00000014771
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti WFDC8 pAb (ATL-HPA071119 w/enhanced validation) – 1 Found

Leir, Shih-Hsing; Yin, Shiyi; Kerschner, Jenny L; Cosme, Wilmel; Harris, Ann. An atlas of human proximal epididymis reveals cell-specific functions and distinct roles for CFTR. Life Science Alliance. 2020;3(11)