Protein Description: WEE1 homolog 2
Gene Name: WEE2
Alternative Gene Name: FLJ16107
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037159: 43%, ENSRNOG00000026446: 41%
Entrez Gene ID: 494551
Uniprot ID: P0C1S8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WEE2
Alternative Gene Name: FLJ16107
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037159: 43%, ENSRNOG00000026446: 41%
Entrez Gene ID: 494551
Uniprot ID: P0C1S8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DIDKELRQKLNFSYCEETEIEGQKKVEESREASSQTPEKGEVQDSEAKGTPPWTPLSNVHELDTSSEKDKESPDQILRTPVSHPLKC |
Documents & Links for Anti WEE2 pAb (ATL-HPA054280) | |
Datasheet | Anti WEE2 pAb (ATL-HPA054280) Datasheet (External Link) |
Vendor Page | Anti WEE2 pAb (ATL-HPA054280) at Atlas |
Documents & Links for Anti WEE2 pAb (ATL-HPA054280) | |
Datasheet | Anti WEE2 pAb (ATL-HPA054280) Datasheet (External Link) |
Vendor Page | Anti WEE2 pAb (ATL-HPA054280) |