Description
Product Description
Protein Description: WEE1 G2 checkpoint kinase
Gene Name: WEE1
Alternative Gene Name: WEE1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031016: 95%, ENSRNOG00000010017: 95%
Entrez Gene ID: 7465
Uniprot ID: P30291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WEE1
Alternative Gene Name: WEE1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031016: 95%, ENSRNOG00000010017: 95%
Entrez Gene ID: 7465
Uniprot ID: P30291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQ |
Gene Sequence | LLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQ |
Gene ID - Mouse | ENSMUSG00000031016 |
Gene ID - Rat | ENSRNOG00000010017 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti WEE1 pAb (ATL-HPA068845) | |
Datasheet | Anti WEE1 pAb (ATL-HPA068845) Datasheet (External Link) |
Vendor Page | Anti WEE1 pAb (ATL-HPA068845) at Atlas Antibodies |
Documents & Links for Anti WEE1 pAb (ATL-HPA068845) | |
Datasheet | Anti WEE1 pAb (ATL-HPA068845) Datasheet (External Link) |
Vendor Page | Anti WEE1 pAb (ATL-HPA068845) |