Description
Product Description
Protein Description: WD repeat domain 90
Gene Name: WDR90
Alternative Gene Name: C16orf15, C16orf16, C16orf17, C16orf18, C16orf19, FLJ36483, KIAA1924
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073434: 59%, ENSRNOG00000020006: 61%
Entrez Gene ID: 197335
Uniprot ID: Q96KV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: WDR90
Alternative Gene Name: C16orf15, C16orf16, C16orf17, C16orf18, C16orf19, FLJ36483, KIAA1924
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073434: 59%, ENSRNOG00000020006: 61%
Entrez Gene ID: 197335
Uniprot ID: Q96KV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GFHSLEPWAQLEASDIHTAAAGTHVLTHESAEVPVARTGSCEGFLPDPVLRLKGVIGFGGHGTRQALWTPDGAAVVYPCHAVIVVLLV |
Gene Sequence | GFHSLEPWAQLEASDIHTAAAGTHVLTHESAEVPVARTGSCEGFLPDPVLRLKGVIGFGGHGTRQALWTPDGAAVVYPCHAVIVVLLV |
Gene ID - Mouse | ENSMUSG00000073434 |
Gene ID - Rat | ENSRNOG00000020006 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti WDR90 pAb (ATL-HPA061785) | |
Datasheet | Anti WDR90 pAb (ATL-HPA061785) Datasheet (External Link) |
Vendor Page | Anti WDR90 pAb (ATL-HPA061785) at Atlas Antibodies |
Documents & Links for Anti WDR90 pAb (ATL-HPA061785) | |
Datasheet | Anti WDR90 pAb (ATL-HPA061785) Datasheet (External Link) |
Vendor Page | Anti WDR90 pAb (ATL-HPA061785) |